Oto-design.net valuation and analysis

Robots.txt Information
Robot Path Permission
GoogleBot /
BingBot /
BaiduSpider /
YandexBot /
Meta Tags
Title  
Description N/A
Keywords N/A
Server Information
WebSite oto-design favicon www.oto-design.net
Host IP 219.94.129.163
Location Osaka, Ōsaka, Japan
Related Websites
Site Rank
More to Explore
partidoliberalsp.com.br
partnersimob.com
passarodourado.com.br
pdconsorcio.com.br
peluqueriajesusmorales.com
penteadossonialopes.com.br
pepeesofia.com.br
pipiocrazyp.blogspot.com
pixida2-my.sharepoint.com
plij.or.jp
rosemarywhitepediatricservices.com
rossinisrestaurant.com
Oto-design.net Valuation
US$3,443
Last updated: Jul 17, 2022

Oto-design.net has global traffic rank of 24,271,902. Oto-design.net has an estimated worth of US$ 3,443, based on its estimated Ads revenue. Oto-design.net receives approximately 125 unique visitors each day. Its web server is located in Osaka, Ōsaka, Japan, with IP address 219.94.129.163. According to SiteAdvisor, oto-design.net is safe to visit.

Traffic & Worth Estimates
Purchase/Sale Value US$3,443
Daily Ads Revenue US$1
Monthly Ads Revenue US$56
Yearly Ads Revenue US$688
Daily Unique Visitors 125
Note: All traffic and earnings values are estimates.
Traffic Ranks
Global Rank 24,271,902
Delta (90 Days) 0
Most Popular In Country N/A
Country Rank N/A
DNS Records
Host Type TTL Data
oto-design.net A 3600 IP: 219.94.129.163
oto-design.net MX 3600 Priority: 10
Target: oto-design.net.
oto-design.net NS 3600 Target: ns2.dns.ne.jp.
oto-design.net NS 3600 Target: ns1.dns.ne.jp.
oto-design.net SOA 3600 MNAME: master.dns.ne.jp.
RNAME: tech.sakura.ad.jp.
Serial: 2007052515
Refresh: 3600
Retry: 900
Expire: 3600000
Minimum TTL: 3600
HTTP Headers
HTTP/1.1 200 OK
Server: nginx
Date: Sun, 17 Jul 2022 17:10:35 GMT
Content-Type: text/html
Content-Length: 404
Connection: keep-alive
Last-Modified: Sat, 06 Aug 2016 22:19:00 GMT
ETag: "194-5396e91de3d00"
Accept-Ranges: bytes

Oto-design.net Whois Information
   Domain Name: OTO-DESIGN.NET
   Registry Domain ID: 986943442_DOMAIN_NET-VRSN
   Registrar WHOIS Server: whois.jprs.jp
   Registrar URL: http://jprs.jp/registrar/
   Updated Date: 2022-03-25T16:30:56Z
   Creation Date: 2007-05-22T05:43:17Z
   Registry Expiry Date: 2023-05-22T05:43:17Z
   Registrar: Japan Registry Services Co., Ltd.
   Registrar IANA ID: 1485
   Registrar Abuse Contact Email: gtld-abuse@jprs.jp
   Registrar Abuse Contact Phone: +81.352158457
   Domain Status: ok https://icann.org/epp#ok
   Name Server: NS1.DNS.NE.JP
   Name Server: NS2.DNS.NE.JP
   DNSSEC: unsigned
   URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

Domain Name: OTO-DESIGN.NET
Registry Domain ID: 986943442_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.jprs.jp
Registrar URL: https://jprs.jp/registrar/
Updated Date: 2022-03-25T16:30:56Z
Creation Date: 2007-05-22T05:43:17Z
Registrar Registration Expiration Date: 2023-05-22T05:43:17Z
Registrar: Japan Registry Services Co.,Ltd.(JPRS)
Registrar IANA ID: 1485
Registrar Abuse Contact Email: gtld-abuse@jprs.jp
Registrar Abuse Contact Phone: +81.352158457
Domain Status: ok  https://icann.org/epp#ok
Registry Registrant ID: Not Available From Registry
Registrant Name: nori_ringo
Registrant Street: 1-9-26-3F Kyutaro-cho, Chuo-ku
Registrant City: Osaka
Registrant State/Province: Osaka
Registrant Postal Code: 541-0056
Registrant Country: JP
Registrant Phone: +81.662654830
Registrant Email: nic-staff@sakura.ad.jp
Registry Admin ID: Not Available From Registry
Admin Name: SAKURA internet Inc.
Admin Street: 11F,1-12-12,Umeda,Kita-ku
Admin City: Osaka
Admin State/Province: Osaka
Admin Postal Code: 530-0001
Admin Country: JP
Admin Phone: +81.664768790
Admin Email: nic-staff@sakura.ad.jp
Registry Tech ID: Not Available From Registry
Tech Name: SAKURA internet Inc.
Tech Street: 11F,1-12-12,Umeda,Kita-ku
Tech City: Osaka
Tech State/Province: Osaka
Tech Postal Code: 530-0001
Tech Country: JP
Tech Phone: +81.664768790
Tech Email: nic-staff@sakura.ad.jp
Name Server: NS1.DNS.NE.JP
Name Server: NS2.DNS.NE.JP
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

JPRS WHOIS LEGAL DISCLAIMER:

JPRS reserves the right to modify or change these terms at any time without prior or subsequent notification of any kind.

For further information, use 'whois -h whois.jprs.jp help'. To express Japanese output, add '/j' at the end of command, e.g. 'whois -h whois.jprs.jp xxx/j'.